PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG023889t1
Common NameTCM_023889
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 688aa    MW: 74758.8 Da    PI: 7.1676
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG023889t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.35.9e-12185247163
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       e+e kr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +   +L +++     e a+l++++
  Thecc1EG023889t1 185 EEEEKRRARLMRNRESAQLSRQRKKHYVEELEDKVRTMHSTIADLNNKIAYFMAENATLRQQL 247
                       6889********************************************999999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001703.5E-11185247IPR004827Basic-leucine zipper domain
SMARTSM003385.8E-17185249IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.634187250IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-17189249No hitNo description
SuperFamilySSF579595.06E-12189247No hitNo description
CDDcd147042.64E-21190241No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MAEAPAETVM GSELESLAIP PLDPLYLSTD LGFSLDDHDD FQITFDDFDQ FCFPSDSEHL  60
LIPDSSTTPD SDVERYLNSS SPELGSCNGP DSSGNSHSPL SSSGSGNCAS AVSEAMNATS  120
PDSENIVDQK ISVEEIGKRR VSKRKKDREE TDSSKCRRSS LTPSVNNSNS NSDNNNNNNS  180
NAPSEEEEKR RARLMRNRES AQLSRQRKKH YVEELEDKVR TMHSTIADLN NKIAYFMAEN  240
ATLRQQLSTA GGGGGGGGAV MCPPQPLPMP MYPPMAYPWV PCAPPYVMKP PGSQVPLVPI  300
PRLKPQQPPV PASKAKKNES KTKKVASVSL LGMLFFILLF GGLAPIVNDR YDNTPVGSGF  360
VGDGFYEVHR GRVLRVDGHL NGSNNSRDVA FSYGKFDRRN RVHGRGSESG VEQKEKGAHS  420
VPGYMSNGGE PLTASLYVPR NDKLVKIDGN LIIHSVLASE KAMASHKASQ IKNEETGLAI  480
PNNFSPALAI PDARENGGKR SREYRNPAER QMALSSGNAD ALKDHFKSTV ADGKMQQWFR  540
EGLAGPMLSS GMCTEVFQFD VSAAIVPASS VTNVSAEHHQ NATRHNKGRN RRILHGHPVP  600
LSRSDVNITE QHVGRNSPKE NFKGNKTASS MVVSVLFDPR EAGDGDIDDM IAPKPLSRIF  660
VVVLVDSVKY VTYSCMLPLP GLHLMTA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138144RRVSKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028261.10.0Transcription factor hy5, putative
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A061EVU50.0A0A061EVU5_THECC; Transcription factor hy5, putative
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-157bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]